PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01750g08006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 633aa    MW: 70396.5 Da    PI: 7.662
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01750g08006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.84.4e-093794161954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yp+ +++  L+k++gLt +qV++WF N R +
  Niben101Scf01750g08006.1 379 FEHflHPYPKDSDKIMLSKQTGLTRSQVSNWFINARVR 416
                               554459******************************88 PP

2BELL114.36.5e-37245316172
                      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               +rqe q+kkakL+++leeV++rY+qy++q+q+++s Fe+vag+gsak+Yt+lAl+aiS++FrcLkd i++qi
  Niben101Scf01750g08006.1 245 QRQEFQMKKAKLVTMLEEVEQRYRQYHQQMQIIVSTFEQVAGIGSAKSYTQLALHAISKQFRCLKDTIVGQI 316
                               699*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-56168314IPR006563POX domain
PfamPF075264.6E-47173312IPR006563POX domain
PROSITE profilePS5007111.693357420IPR001356Homeobox domain
SMARTSM003891.2E-9360424IPR001356Homeobox domain
CDDcd000861.55E-11360421No hitNo description
SuperFamilySSF466891.45E-16361426IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-28363426IPR009057Homeodomain-like
PfamPF059206.7E-18377416IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MYYQGTSDNI HQAADGNIQT LYLMNPSYIH QGYTDTQHHH HQQQIIPHAL MQHFVGVPLP  60
AVSLHDQNHA QLIHRLWNQS GSGGGNGIHH QSQIIPSSTV VSATSCGGTT TDLASQLGFQ  120
RPITMSPTQQ QQRQSGLSLS LSPQQQQLSF NNISGQNQVG SNINRGLDGI SSMVLGSKYL  180
KAAQELLDEV VSVGKCTKGG EVEKEELINN ESILPWASHD VNTNNGGSES SSKQKYGVAE  240
LTTSQRQEFQ MKKAKLVTML EEVEQRYRQY HQQMQIIVST FEQVAGIGSA KSYTQLALHA  300
ISKQFRCLKD TIVGQIKATS KSLGEEDEGV GGKTRLKFVD HHLRQQRALQ QLGMMQPNAW  360
RPQRGLPERA VSVLRAWLFE HFLHPYPKDS DKIMLSKQTG LTRSQVSNWF INARVRLWKP  420
MVEEMYLEEV KNNQEQNSSS EGNKNKNESN KEKMVSKSSG PQENGTPAEI ATSTSSTSPP  480
ACGSFQAVQA HNFSFLGSLN MENNTTAKKP RNHDMHNNSP SSILSSVEMM AETKARDHQS  540
NKGFNPLMDA AAVYTMGEFG RFNPHEQMAA TNFHGNNGVS LTLGLPPNSE NQSQQSYQNT  600
IEFNRMSYED IDFQNKRFPS QLLPDFVAGN LGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-16366424563Homeobox protein Meis2
3k2a_B8e-16366424563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009773899.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009773900.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotO656859e-97BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLQ7Y0Z70.0Q7Y0Z7_SOLLC; Bell-like homeodomain protein 2
STRINGSolyc06g074120.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.38e-93BEL1-like homeodomain 1